Ecosyste.ms: Awesome
An open API service indexing awesome lists of open source software.
https://github.com/BytedProtein/ByProt
https://github.com/BytedProtein/ByProt
Last synced: about 1 month ago
JSON representation
- Host: GitHub
- URL: https://github.com/BytedProtein/ByProt
- Owner: BytedProtein
- License: apache-2.0
- Created: 2023-01-31T17:41:47.000Z (almost 2 years ago)
- Default Branch: main
- Last Pushed: 2024-03-11T22:31:33.000Z (9 months ago)
- Last Synced: 2024-08-03T14:08:44.892Z (4 months ago)
- Language: Python
- Size: 839 KB
- Stars: 144
- Watchers: 14
- Forks: 13
- Open Issues: 9
-
Metadata Files:
- Readme: README.md
- License: LICENSE
Awesome Lists containing this project
- awesome-protein-design-software - LM-Design - [paper](https://arxiv.org/abs/2302.01649) (Design)
README
# ByProt
[![Paper](http://img.shields.io/badge/ICML_2023-arXiv.2302.01649-B31B1B.svg)](https://arxiv.org/abs/2302.01649)ByProt is a versatile toolkit designed for generative learning in protein research. It currently focuses primarily on structure-based sequence design (a.k.a., fixedbb), offering the following key features:
- **Efficient non-autoregressive ProteinMPNN variant:**
ByProt provides an efficient and effective non-autoregressive variant of [ProteinMPNN](https://github.com/dauparas/ProteinMPNN), a powerful tool for protein fixed-backbone sequence design.
- **Official implementation of LM-Design :**
ByProt serves as the official implementation of LM-Design, the state-of-the-art protein sequence design model from the paper titled **"Structure-informed Language Models Are Protein Designers,"** which was presented at ICML 2023 (oral). For more details, please refer to the [paper](https://arxiv.org/abs/2302.01649).![LM-Design](./assets/lm_design.png)
We are continuously expanding ByProt's capabilities to encompass a broader range of tasks and features. Stay tuned for updates as we strive to provide an even more comprehensive toolkit for protein research.
## Installation
```bash
# clone project
git clone --recursive https://url/to/this/repo/ByProt.git
cd ByProt# create conda virtual environment
env_name=ByProtconda create -n ${env_name} python=3.7 pip
conda activate ${env_name}# automatically install everything else
bash install.sh
```## Structure-based protein sequence design (inverse folding)
**Pretrained model weights** ([Zenodo](https://zenodo.org/records/10046338))
| model | training data | checkpoint |
|----------------------|------------|------------|
| `protein_mpnn_cmlm` | cath_4.2 | [link](https://zenodo.org/records/10046338/files/protein_mpnn_cmlm.zip?download=1) |
| `lm_design_esm1b_650m` | cath_4.2 | [link](https://zenodo.org/records/10046338/files/lm_design_esm1b_650m.zip?download=1) |
| `lm_design_esm2_650m` | cath_4.2 | [link](https://zenodo.org/records/10046338/files/lm_design_esm2_650m.zip?download=1) |
| `lm_design_esm2_650m` | multichain | [link](https://zenodo.org/records/10046338/files/lm_design_esm2_650m_multichain.zip?download=1) |### Data
**Download the preproceesd CATH datasets**
- CATH 4.2 dataset provided by [Generative Models for Graph-Based Protein Design (Ingraham et al, NeurIPS'19)](https://papers.nips.cc/paper/2019/hash/f3a4ff4839c56a5f460c88cce3666a2b-Abstract.html)
- CATH 4.3 dataset provided by [Learning inverse folding from millions of predicted structures (Hsu et al, ICML'22)](https://www.biorxiv.org/content/10.1101/2022.04.10.487779v1)
```bash
bash scripts/download_cath.sh
```
Go check `configs/datamodule/cath_4.*.yaml` and set `data_dir` to the path of the downloaded CATH data.**Dowload PDB complex data (multichain)**
This dataset curated protein (multichain) complexies from Protein Data Bank (PDB).
It is provided by [Robust deep learning-based protein sequence design using ProteinMPNN](https://www.biorxiv.org/content/10.1101/2022.06.03.494563v1).
See their [github page](https://github.com/dauparas/ProteinMPNN/blob/main/training/README.md) for more details.
```bash
bash scripts/download_multichain.sh
```
Go check `configs/datamodule/multichain.yaml` and set `data_dir` to the path of the downloaded multichain data.OK we now get everything ready and can start to train a model.
### Training
In the following sections, we will use CATH 4.2 dataset as an runing example. You can likewise build your models on the multichain dataset to accommodate protein complexies.#### Example 1: Non-autoregressive (NAR) ProteinMPNN baseline
Training NAR ProteinMPNN with conditional masked language modeling (CMLM)
```bash
export CUDA_VISIBLE_DEVICES=0
# or use multi-gpu training when you want:
# export CUDA_VISIBLE_DEVICES=0,1exp=fixedbb/protein_mpnn_cmlm
dataset=cath_4.2
name=fixedbb/${dataset}/protein_mpnn_cmlmpython ./train.py \
experiment=${exp} datamodule=${dataset} name=${name} \
logger=tensorboard trainer=ddp_fp16
```Some flags for training:
| Argument | Usage |
|-----------------------|---------------------------------------------------------------------------------------------------------------------------------|
| `experiment` | experiment config. see `ByProt/configs/experiment/` folder |
| `datamodule` | dataset config. see `ByProt/configs/datamodule` folder |
| `name` | experiment name, deciding the directory path your experiment saving to, e.g., `/root/research/projects/ByProt/run/logs/${name}` |
| `logger` | config of which ml experiment logger to use, e.g., tensorboard. |
| `train.force_restart` | set to `true` to force retrain the experiment under `${name}`. otherwise will resume training from the last checkpoint. |#### Example 2: LM-Design
Training LM-Design upon ESM-1b 650M.
> Training would take approxmiately 6 hours on one A100 GPU.
```bash
exp=fixedbb/lm_design_esm1b_650m
dataset=cath_4.2
name=fixedbb/${dataset}/lm_design_esm1b_650m./train.py \
experiment=${exp} datamodule=${dataset} name=${name} \
logger=tensorboard trainer=ddp_fp16
```Building LM-Design upon ESM-2 series using `exp=fixedbb/lm_design_esm2*`. Please check `ByProt/configs/experiment/fixedbb`.
### Evaluation/inference on valid/test datasets
```bash
dataset=cath_4.2
# name=fixedbb/${dataset}/protein_mpnn_cmlm
name=fixedbb/${dataset}/lm_design_esm1b_650m
exp_path=/root/research/projects/ByProt/run/logs/${name}python ./test.py \
experiment_path=${exp_path} \
data_split=test ckpt_path=best.ckpt mode=predict \
task.generator.max_iter=5
```Some flags for generation
| Argument | Usage |
|--------------------------------------|------------------------------------------------------------------------------------------------------------------|
| `experiment_path` | folder that saves experiment (.hydra, checkpoints, tensorboard, etc) |
| `data_split` | `valid` or `test` dataset. |
| `mode` | `predict` for generating sequence & calculating amino acid sequence recovery; `test` for evaluation for nll, ppl |
| | |
| `task.generator` | arguments for sequence generator/sampler |
| - `max_iter=` | maximum decoding iteration (default: `5` for LM-Design, `1` for ProtMPNN-CMLM) |
| - `strategy=[denoise, mask_predict]` | decoding strategy. (default: `denoise` for LM-Design, `mask_predict` for ProtMPNN-CMLM) |
| - `temperature=` | temperature for sampling. set to 0 to disable for deterministic sampling (default: `0`) |
| - `eval_sc=` | additional evaluating scTM score using ESMFold. (default: `false`) |### Designing sequences from a pdb file using a trained model in Notebook
**Example 1: ProteinMPNN-CMLM**
```python
from byprot.utils.config import compose_config as Cfg
from byprot.tasks.fixedbb.designer import Designer# 1. instantialize designer
exp_path = "/root/research/projects/ByProt/run/logs/fixedbb/cath_4.2/protein_mpnn_cmlm"
cfg = Cfg(
cuda=True,
generator=Cfg(
max_iter=1,
strategy='mask_predict',
temperature=0,
eval_sc=False,
)
)
designer = Designer(experiment_path=exp_path, cfg=cfg)# 2. load structure from pdb file
pdb_path = "/root/research/projects/ByProt/data/3uat_variants/3uat_GK.pdb"
designer.set_structure(pdb_path)# 3. generate sequence from the given structure
designer.generate()# 4. calculate evaluation metircs
designer.calculate_metrics()
## prediction: SSYNPPILLLGPFAEELEEELVEENPERAGRPVPFTTEPPSPDETEGETYLYISSLEEAEELIESNRFLEAGEENNELVGISLEAIRSVARAGKLAILDTGGEAVEKLEEANIEPIVIFLVPKSVEDVRRVFPDLTEEEAEELTSEDEELLEEFKELLDAVVSGSTLEEVLEEIREVIEEASS
## recovery: 0.37158469945355194
```**Example 2: LM-Design**
```python
from byprot.utils.config import compose_config as Cfg
from byprot.tasks.fixedbb.designer import Designer# 1. instantialize designer
exp_path = "/root/research/projects/ByProt/run/logs/fixedbb/cath_4.2/lm_design_esm2_650m"
cfg = Cfg(
cuda=True,
generator=Cfg(
max_iter=5,
strategy='denoise',
temperature=0,
eval_sc=False,
)
)
designer = Designer(experiment_path=exp_path, cfg=cfg)# 2. load structure from pdb file
pdb_path = "/root/research/projects/ByProt/data/3uat_variants/3uat_GK.pdb"
designer.set_structure(pdb_path)# 3. generate sequence from the given structure
designer.generate()
# you can override generator arguments by passing generator_args, e.g.,
designer.generate(
generator_args={
'max_iter': 5,
'temperature': 0.1,
}
)# 4. calculate evaluation metircs
designer.calculate_metrics()
## prediction: LNYTRPVIILGPFKDRMNDDLLSEMPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREEMEKDIQNHEFIEAGEYNDNLYGTSIESVREVAMEGKHCILDVSGNAIQRLIKADLYPIAIFIRPRSVENVREMNKRLTEEQAKEIFERAQELEEEFMKYFTAIVEGDTFEEIYNQVKSIIEEESG
## recovery: 0.7595628415300546
```** Example 3: Inpainting **
For some use cases, you may want to do inpainting on some segments of interest only while the rest of the protein remains the same (e.g., designing antibody CDRs). Here is a simple example with `inpaint` interface:```python
pdb_path = "/root/research/projects/ByProt/data/pdb_samples/5izu_proc.pdb"
designer.set_structure(pdb_path)start_ids = [1, 50]
end_ids = [10, 100]for i in range(5):
out, ori_seg, designed_seg = designer.inpaint(
start_ids=start_ids, end_ids=end_ids,
generator_args={'temperature': 1.0}
)
print(designed_seg)
print('Original Segments:')
print(ori_seg)
```
The output looks like:
```bash
loading backbone structure from /root/research/projects/ByProt/data/pdb_samples/5izu_proc.pdb.
[['MVKSLFRHRT'], ['DEPIEEFTPTPAFPALQRLSSVDVEGVAWRAGLRTGDFLLEVNGVNVVKVG']]
[['MTKALFRHQT'], ['ETPIEEFTPTPAFPALQHLSSVDVEGAAYRAGLRTGDFLIEVNGVNVVKVG']]
[['STESLFRHAT'], ['ETPIEEFTPTPAFPALQHLSSVDVEGVAWRAGLRTGDFLIEVNGINVVKVG']]
[['ATARMFRHLT'], ['ETPIEEFTPTPAFPALQYLSSVDVEGVAWRAGLKTGDFLIEVNGVNVVKVG']]
[['ARKAKFRRYT'], ['ETPIEEFTPTPAFPALQVLSSVDVEGVAWRAGMRTGDFLLEVNGVNVVKVG']]
[['ADARLFREYT'], ['ETPIEEFTPTPAFPALQHLSAVDVEGVAWRAGLLTGDFLIEVNGVNVVKVG']]
[['ALRALFKHST'], ['DTPIEEFTPTPAFPALQYMSSVEVEGVAWRAGLRTGDFLIEVNGVNVVKVG']]
[['MLKMLFRHYT'], ['ETPIEEFTPTPAFPALQYLSSVDIDGMAWRAGLRTGDFLIEVNGDNVVKVG']]
[['ADKALFRHHT'], ['STPIEEFTPTPAFPALQYLESVDVDGVAYRAGLCTGDFLIEVNGVNVVKVG']]
[['AAAAAFRHST'], ['KTPIEEFTPTPAFPALQYLSRVEVDGMAWRAGLRTGDFLLEVNGVNVVRVG']]
Original Segments:
[['RTKRLFRHYT'], ['ETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVG']]
```## Acknowledgements
ByProt extends its gratitude to the following projects and individuals:- [PyTorch Lightning](https://www.pytorchlightning.ai/) and [lightning-hydra-template](https://github.com/ashleve/lightning-hydra-template) for providing a robust foundation for our development process.
ByProt draws inspiration and leverages/modifies implementations from the following repositories:
- [jingraham/neurips19-graph-protein-design](https://github.com/jingraham/neurips19-graph-protein-design) for the preprocessed CATH dataset and data pipeline implementation.
- [facebook/esm](https://github.com/facebookresearch/esm/) for their ESM implementations, pretrained model weights, and data pipeline components like `Alphabet`.
- [dauparas/ProteinMPNN](https://github.com/dauparas/ProteinMPNN/) for the ProteinMPNN implementation and multi-chain dataset.
- [A4Bio/PiFold](https://github.com/A4Bio/PiFold) for their PiFold implementation.
- [jasonkyuyim/se3_diffusion](https://github.com/jasonkyuyim/se3_diffusion) for their self-consistency structural evaluation implementation.We express our sincere appreciation to the authors of these repositories for their invaluable contributions to the development of ByProt.
## Citation
```python
@inproceedings{zheng2023lm_design,
title={Structure-informed Language Models Are Protein Designers},
author={Zheng, Zaixiang and Deng, Yifan and Xue, Dongyu and Zhou, Yi and YE, Fei and Gu, Quanquan},
booktitle={International Conference on Machine Learning},
year={2023}
}
```