https://github.com/anergictcell/atg
A Rust library and CLI tool to handle genomic transcripts
https://github.com/anergictcell/atg
bioinformatics bioinformatics-tool cli-app converter genomics gtf transcriptomics
Last synced: 10 months ago
JSON representation
A Rust library and CLI tool to handle genomic transcripts
- Host: GitHub
- URL: https://github.com/anergictcell/atg
- Owner: anergictcell
- License: mit
- Created: 2021-09-21T05:43:36.000Z (over 4 years ago)
- Default Branch: main
- Last Pushed: 2025-03-07T17:05:34.000Z (11 months ago)
- Last Synced: 2025-04-17T12:57:07.288Z (10 months ago)
- Topics: bioinformatics, bioinformatics-tool, cli-app, converter, genomics, gtf, transcriptomics
- Language: Rust
- Homepage: https://crates.io/crates/atg
- Size: 475 KB
- Stars: 4
- Watchers: 1
- Forks: 0
- Open Issues: 1
-
Metadata Files:
- Readme: README.md
- Changelog: CHANGELOG.md
- License: LICENSE
Awesome Lists containing this project
README
# ATG
Convert your genomic reference data between formats with a single tool. _ATG_ handles the conversion from and to GTF, GenePred(ext) and Refgene. You can generate bed files, fasta sequences or custom feature sequences. A single tool for all your conversion.
| File format | Can be used as source | Can be created |
| ----------- | ------------- | -------- |
| GTF | Yes | Yes |
| GenePred (extended) | Yes | Yes |
| RefGene | Yes | Yes |
| GenePred (simple) | No | Yes |
| Bed | No | Yes |
| Fasta | No | Yes (multiple options) |
| SpliceAI gene annotation | No | Yes |
| Quality Checks | No | Yes |
**Reasons to use _ATG_**
* No need to maintain multiple tools for one-way conversions (`gtfToGenePred`, `genePredToGtf`, etc). _ATG_ handles many formats and can convert in both directions.
* Speed: _ATG_ is really fast - almost twice as fast as `gtfToGenePred`.
* Robust parser: It handles GTF, GenePred with all extras according to spec.
* Low memory footprint: It also runs on machines with little RAM.
* Extra features, such as quality control and correctness checks.
* Open for contributions: Every help is welcome improve ATG or to add more functionality.
* You can also use _ATG_ as a library for your own Rust projects.
## ATG command line tool
### Install
There are currently 3 different options how to install _ATG_:
##### cargo
The easiest way to install _ATG_ is to use `cargo` (if you have `cargo` and `rust` installed)
```bash
cargo install atg
```
##### Pre-built binaries
You can download pre-built binaries for Linux and Mac from [Github](https://github.com/anergictcell/atg/releases).
##### From source
You can also build _ATG_ from source (if you have the rust toolchains installed):
```bash
git clone https://github.com/anergictcell/atg.git
cd atg
cargo build --release
```
### Usage
The main CLI arguments are
- `-f`, `--from`: Specify the file format of the source (e.g. `gtf`, `genepredext`, `refgene`)
- `-t`, `--to`: Specify the target file format (e.g. `gtf`, `genepred`, `bed`, `fasta` etc)
- `-i`, `--input`: Path to source file. (Use `/dev/stdin` if you are using _atg_ in a pipe)
- `-o`, `--output`: Path to target file. Existing files will be overwritten. (Use `/dev/stdout` if you are using _atg_ in a pipe)
- `-v`, `-vv`, `-vvv`: Verbosity (info, debug, trace)
- `-h`, `--help`: Print the help dialog with detailed usage instructions.
Additional, optional arguments:
- `-g`, `--gtf-source`: Specify the source for GTF output files. Defaults to `atg`
- `-r`, `--reference`: Path of a reference genome fasta file. Required for fasta output
- `-c`, `--genetic-code`: Specify which genetic code to use for translating the transcripts. Genetic codes can be specified per chromosome by specifying the chromsome and the code, separated by `:` (e.g. `-c chrM:vertebrate mitochondrial`). They can also be specified for all chromsomes by omitting the chromosome (e.g. `-c vertebrate mitochondrial`). The argument can be specified multiple times (e.g: `-c "standard" -c "chrM:vertebrate mitochondrial" -c "chrAYN:alternative yeast nuclear"`). The code names are based on the `name` field from the [NCBI specs](https://www.ncbi.nlm.nih.gov/IEB/ToolBox/C_DOC/lxr/source/data/gc.prt) but all lowercase characters. Alternatively, you can also specify the amino acid lookup table directly: `-c "chrM:FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG"`. Defaults to `standard`.
- `-q`, `--qc-check`: Specify QC-checks for removing transcripts from the output
#### Examples:
```bash
## Convert a GTF file to a RefGene file
atg --from gtf --to refgene --input /path/to/input.gtf --output /path/to/output.refgene
## Convert a GTF file to a GenePred file
atg --from gtf --to genepred --input /path/to/input.gtf --output /path/to/output.genepred
## Convert a GTF file to a GenePredExt file
atg --from gtf --to genepredext --input /path/to/input.gtf --output /path/to/output.genepredext
## Convert RefGene to GTF
atg --from refgene --to gtf --input /path/to/input.refgene --output /path/to/output.gtf
## Convert RefGene to bed
atg --from refgene --to bed --input /path/to/input.refgene --output /path/to/output.bed
## Convert a GTF file to a RefGene file, remove all transcript without proper start and stop codons
atg --from gtf --to refgene --input /path/to/input.gtf --output /path/to/output.refgene --qc-check start --qc-check stop --reference /path/to/fasta.fa
```
### Supported `--output` formats
#### gtf
Output in [GTF](http://genome.ucsc.edu/FAQ/FAQformat.html#format4) format.
```text
chr9 ncbiRefSeq.2021-05-17 transcript 74526555 74600974 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 exon 74526555 74526752 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 5UTR 74526555 74526650 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 CDS 74526651 74526752 . + 0 gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 exon 74561922 74562028 . + . gene_id "C9orf85"; transcript_id "NM_001365057.2";
chr9 ncbiRefSeq.2021-05-17 CDS 74561922 74562026 . + 0 gene_id "C9orf85"; transcript_id "NM_001365057.2";
...
```
You can specify the value of the `source` column manually using the `--gtf-source`/`-g` option. Defaults to `atg`
#### refgene
Output in the [refGene](http://rohsdb.cmb.usc.edu/GBshape/cgi-bin/hgTables?hgsid=583_AkEae6dMkhjf5kd9BxNksFo9ySiK&hgta_doSchemaDb=mm10&hgta_doSchemaTable=refGene) format, as used by some UCSC and NCBI RefSeq services
```text
0 NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232, 0 ACTB cmpl cmpl 0,1,0,0,0,-1,
0 NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
0 NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
0 NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487, 0 ZBTB16 cmpl cmpl -1,0,2,1,1,1,1,
```
#### genepred(ext)
Output in the [GenePred(Ext)](http://genome.ucsc.edu/FAQ/FAQformat#format9) format, as used by some UCSC and NCBI RefSeq services
**GenePred:**
```text
NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232,
NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383,
NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383,
NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487,
```
**GenePredExt**
```text
NM_001101.5 chr7 - 5566778 5570232 5567378 5569288 6 5566778,5567634,5567911,5568791,5569165,5570154, 5567522,5567816,5568350,5569031,5569294,5570232, 0 ACTB cmpl cmpl 0,1,0,0,0,-1,
NM_001203247.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543561,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
NM_001203248.2 chr7 - 148504474 148581383 148504737 148544390 20 148504474,148506162,148506401,148507424,148508716,148511050,148512005,148512597,148513775,148514313,148514968,148516687,148523560,148524255,148525831,148526819,148529725,148543588,148544273,148581255, 148504798,148506247,148506482,148507506,148508812,148511229,148512131,148512638,148513870,148514483,148515209,148516779,148523724,148524358,148525972,148526940,148529842,148543690,148544397,148581383, 0 EZH2 cmpl cmpl 2,1,1,0,0,1,1,2,0,1,0,1,2,1,1,0,0,0,0,-1,
NM_001354750.2 chr11 + 113930432 114127487 113934022 114121277 7 113930432,113933932,114027058,114057673,114112888,114117919,114121047, 113930864,113935290,114027156,114057760,114113059,114118087,114127487, 0 ZBTB16 cmpl cmpl -1,0,2,1,1,1,1,
```
#### bed
Output in [bed](http://genome.ucsc.edu/FAQ/FAQformat#format1) format.
```text
chr7 5566778 5570232 ACTB:NM_001101.5 - 5567378 5569288 212,16,48 6 744,182,439,240,129,78 0,856,1133,2013,2387,3376
chr11 113930432 114127487 ZBTB16:NM_001354750.2 + 113934022 114121277 212,16,48 7 432,1358,98,87,171,168,6440 0,3500,96626,127241,182456,187487,190615
chr17 40852292 40897058 EZH1:NM_001321082.2 - 40854549 40880959 212,16,48 20 2318,85,81,82,96,179,126,41,92,197,181,92,164,103,177,121,129,128,91,30 0,2602,3465,4327,4813,5732,7683,8601,9571,12014,12934,17701,18179,18830,19998,22520,27360,28550,30553,44736
```
#### fasta
Writes the cDNA sequence of all transcripts into one file. Please note that the sequence is stranded.
This target format requires a reference genome fasta file that must be specified using `--reference`/`-r`.
*This output allows different `--fasta-format` options:*
- `transcript`: The full transcript sequence (from the genomic start to end position, including introns)
- `exons`: The cDNA sequence of the processed transcript, i.e. the sequence of all exons, including non-coding exons.
- `cds` (default): The CDS of the transcript
```text
>NM_007298.3 BRCA1
ATGGATTTATCTGCTCTTCGCGTTGAAGAAGTACAAAATGTCATTAATGC
TATGCAGAAAATCTTAGAGTGTCCCATCTGTCTGGAGTTGATCAAGGAAC
CTGTCTCCACAAAGTGTGACCACATATTTTGCAAATTTTGCATGCTGAAA
CTTCTCAACCAGAAGAAAGGGCCTTCACAGTGTCCTTTATGTAAGAATGA
TATAACCAAAAGGAGCCTACAAGAAAGTACGAGATTTAGTCAACTTGTTG
...
>NM_001365057.2 C9orf85
ATGAGCTCCCAGAAAGGCAACGTGGCTCGTTCCAGACCTCAGAAGCACCA
GAATACGTTTAGCTTCAAAAATGACAAGTTCGATAAAAGTGTGCAGACCA
AGAAAATTAATGCAAAACTTCATGATGGAGTATGTCAGCGCTGTAAAGAA
GTTCTTGAGTGGCGTGTAAAATACAGCAAATACAAACCATTATCAAAACC
TAAAAAGTGA
...
```
#### fasta-split
Like `fasta` above, but one file for each transcript. Instead of an output file, you must specify an output directory, _ATG_ will save each transcript as `.fasta`, e.g.: `NM_001365057.2.fasta`.
This target format requires a reference genome fasta file that must be specified using `--reference`/`-r`.
*This output allows different `--fasta-format` options:*
- `transcript`: The full transcript sequence (from the genomic start to end position, including introns)
- `exons`: The cDNA sequence of the processed transcript, i.e. the sequence of all exons, including non-coding exons.
- `cds` (default): The CDS of the transcript
#### feature-sequence
cDNA sequence of each feature (5' UTR, CDS, 3'UTR), each in a separate row.
This target format requires a reference genome fasta file that must be specified using `--reference`/`-r`.
```text
BRCA1 NM_007298.3 chr17 41196311 41197694 - 3UTR CTGCAGCCAGCCAC...
BRCA1 NM_007298.3 chr17 41197694 41197819 - CDS CAATTGGGCAGATGTGTG...
BRCA1 NM_007298.3 chr17 41199659 41199720 - CDS GGTGTCCACCCAATTGTG...
BRCA1 NM_007298.3 chr17 41201137 41201211 - CDS ATCAACTGGAATGGATGG...
BRCA1 NM_007298.3 chr17 41203079 41203134 - CDS ATCTTCAGGGGGCTAGAA...
BRCA1 NM_007298.3 chr17 41209068 41209152 - CDS CATGATTTTGAAGTCAGA...
BRCA1 NM_007298.3 chr17 41215349 41215390 - CDS GGGTGACCCAGTCTATTA...
BRCA1 NM_007298.3 chr17 41215890 41215968 - CDS ATGCTGAGTTTGTGTGTG...
BRCA1 NM_007298.3 chr17 41219624 41219712 - CDS ATGCTCGTGTACAAGTTT...
BRCA1 NM_007298.3 chr17 41222944 41223255 - CDS AGGGAACCCCTTACCTGG...
C9orf85 NM_001365057.2 chr9 74526555 74526650 + 5UTR ATTGACAGAA...
C9orf85 NM_001365057.2 chr9 74526651 74526752 + CDS ATGAGCTCCCAGAA...
C9orf85 NM_001365057.2 chr9 74561922 74562028 + CDS AAAATTAATGCAAA...
C9orf85 NM_001365057.2 chr9 74597573 74597573 + CDS A
C9orf85 NM_001365057.2 chr9 74597574 74600974 + 3UTR TGGAGTCTCC...
```
#### spliceai
This is a custom format useful for [SpliceAI](https://github.com/Illumina/SpliceAI)
splice predictions. The repo lists [example files](https://github.com/Illumina/SpliceAI/tree/master/spliceai/annotations).
The output has one gene per row, each gene record contains a consensus transcript, created by merging overlapping exons.
```text
#NAME CHROM STRAND TX_START TX_END EXON_START EXON_END
OR4F5 1 + 69090 70008 69090, 70008,
AL627309.1 1 - 134900 139379 134900,137620, 135802,139379,
```
#### qc
Runs some basic consistency checks on the transcripts:
| QC check | Explanation | Non-Coding vs Coding | requires Fasta File |
| --- | --- | --- | --- |
| Exon | Contains at least one exon | all | no |
| Correct CDS Length | The length of the CDS is divisible by 3 | Coding | no |
| Correct Start Codon | The CDS starts with `ATG` | Coding | yes |
| Correct Stop Codon | The CDS ends with a Stop codon `TAG`, `TAA`, or `TGA` | Coding | yes |
| No upstream Start Codon | The 5'UTR does not contain another start codon `ATG` (This test do not make sense biologically. It is totally fine for a transcript to have upstream `ATG` start cordons that are not utilized but the ribosome.) | Coding | yes |
| No upstream Stop Codon| The CDS does not contain another in-frame stop-codon | Coding | yes |
| No Start codon | The full exon sequence does not contain a start codon `ATG` (Biologically speaking, a non-coding transcript could have `ATG` start codons that are not utilized) | Non-Coding | yes |
| Correct Coordinates | The transcript is within the coordinates of the reference genome | all | yes |
**Test results:**
- `NA` Test could not be performed (e.g. CDS-length for non-coding transcripts), so no conclusion could be drawn
- `OK` The test succeeded with an OK results
- `NOK` The test failed and gave a NOT OK result
```text
Gene transcript Exon CDS Length Correct Start Codon Correct Stop Codon No upstream Start Codon No upstream Stop Codon Correct Coordinates
FAM239A NR_146581.1 OK N/A N/A N/A OK N/A OK
OR5H2 NM_001005482.1 OK OK OK OK OK OK OK
SNX20 NM_001144972.2 OK OK OK OK NOK OK OK
```
#### raw
This is mainly useful for debugging, as it gives a quick glimpse into the Exons and CDS coordinates of the transcripts.
#### bin
Save Transcripts in _ATG_ binary format for faster re-reading.
## ATG as library
_ATG_ uses the _atglib_ library, which is documented inline and available on [docs.rs](https://docs.rs/atglib)
## Known issues
### GTF parsing
- [ ] NM_001371720.1 has two book-ended exons (155160639-155161619 || 155161620-155162101). During input parsing, book-ended features are merged into one exon